PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G324900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Nin-like
Protein Properties Length: 939aa    MW: 102708 Da    PI: 5.9684
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G324900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.85.2e-29592643152
              RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         aek+isle+l++yFs+++k+AAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  Brast01G324900.1.p 592 AEKTISLEVLQQYFSGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 643
                         589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.666582663IPR003035RWP-RK domain
PfamPF020423.3E-26595643IPR003035RWP-RK domain
SuperFamilySSF542773.6E-21834928No hitNo description
PfamPF005642.5E-15844925IPR000270PB1 domain
SMARTSM006668.6E-24844926IPR000270PB1 domain
PROSITE profilePS5174518.625844926IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2404.5E-25844925No hitNo description
CDDcd064073.79E-32845925No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 939 aa     Download sequence    Send to blast
MDIDPSSASH ADGGAGDLWP FDSLTTSLFF SSVSSSPPLS TLPVASSSWL APPSPLWLFD  60
DRQLLPIEVG PAPVSAAAEN AAVAAAAAAA AEDVQRARSG NSDTASKRVE RLSNNKWQFH  120
LSLHDDSTNS SCLFKEKLTH ALRYFKESTD QHLLVQVWAP VKSGDRYVLT TSGQPFVLDH  180
QSIGLLQYRA VSMMYMFSID GDNAGELGLP GRVYKQKVPE WTPNVQYYSS TEYPRLNHAI  240
SYNVHGTVAL PVFDPSVQSC IAVVELIMTS KKINYADEVD KVCKALEAVN LKSTEILDHP  300
NVQICNEGRQ SALVEILEIL TVVCEEHKLP LAQTWVPCKY RSVLAHGGGV KKSCLSFDGS  360
CMGEVCMSTS DVAFHVIDAH MWGFRDACVE HHLQKGQGVS GKAFIYHRPC FSKDISQFCK  420
VEYPLVHYAR MFGLAGCFAV CLQSPYTGDD YYILEFFLPP SCRDEDDQNA LLESILGLIN  480
QCLRNLKVAG NGASNEASLQ LSNVLIVENE DFKTNGHFEN SEGCFRESPE DDTNGVHEFD  540
KGNNKVSEGH LLADDNSQNN GTSVSRPNGS GASDSSLLHK SNKQPERRRG KAEKTISLEV  600
LQQYFSGSLK NAAKSLGVCP TTMKRICRQH GISRWPSRKI NKVNRSLSKL KQVIESVQGS  660
DAAFNLTSIT GPLPTIPVGP SSDSFNIERA NQSKAELSNP AVDGDRDSSL QKSLENGSHF  720
GLLMPQQGFI DTSNNVQLEA DKVSLSRSSS GEGSINSRTS EGSCQGSPAN QTFVCKPIAS  780
TFLEPQPNPE FTKEPFQEPE LPLSRMLIED SGSSKDLKNF FTSATDKPMF APPSNFGPMQ  840
NSGTVTIKAS FKEDIVRFRF PCSSSVMVLK DEVAKRLRMD AGMFDIKYLD DDHEWVKLAC  900
NADLEECMEI SRHSRSHVIR LLVSDIAAHI GSSCGSSG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565547.10.0PREDICTED: protein NLP3
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLA0A0Q3QPV50.0A0A0Q3QPV5_BRADI; Uncharacterized protein
STRINGBRADI2G08177.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein